![[KO Validated] PRMT4/CARM1 Rabbit pAb (A2246)](/upload/resize_cache/iblock/032/340_340_140cd750bba9870f18aada2478b24840a/3tim2mog81ki7kfcdew2ivqnk8l7heo2.jpg "[KO Validated] PRMT4/CARM1 Rabbit pAb (A2246)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] PRMT4/CARM1 Rabbit pAb (A2246)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] PRMT4/CARM1 Rabbit pAb Catalog No. A2246 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1). Sequence GSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNT Gene ID Swiss Prot Synonyms PRMT4 Calculated MW 66kDa Observed MW 63kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T Cellular location Cytoplasm, Nucleus 
Western blot analysis of extracts from normal (control) and PRMT4/CARM1 knockout (KO) 293T cells, using PRMT4/CARM1 antibody (A2246) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using [KO Validated] PRMT4/CARM1 Rabbit pAb (A2246) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using [KO Validated] PRMT4/CARM1 Rabbit pAb (A2246) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using [KO Validated] PRMT4/CARM1 Rabbit pAb (A2246) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 486-603 of human PRMT4/CARM1 (NP_954592.1). KO Validated Validated Isotype IgG