![[KO Validated] MCU Rabbit mAb (A22525)](/upload/resize_cache/iblock/72c/340_340_140cd750bba9870f18aada2478b24840a/nxle63od0k49plf790fle732tepofev5.jpg "[KO Validated] MCU Rabbit mAb (A22525)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MCU Rabbit mAb (A22525)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MCU Rabbit mAb Catalog No. A22525 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57879 Background
Enables calcium channel activity; identical protein binding activity; and uniporter activity. Involved in several processes, including positive regulation of mitochondrial calcium ion concentration; positive regulation of mitochondrial fission; and positive regulation of neutrophil chemotaxis. Acts upstream of or within calcium import into the mitochondrion. Located in mitochondrial inner membrane. Is integral component of mitochondrial inner membrane. Part of uniplex complex.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human MCU (NP_612366.1). Sequence VHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSH Gene ID Swiss Prot Synonyms HsMCU; C10orf42; CCDC109A Calculated MW 40kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:2000 - 1:20000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, NIH/3T3, Mouse spleen, Rat skeletal muscle Cellular location mitochondrial inner membrane, mitochondrion 
Western blot analysis of various lysates, using MCU antibody (A22525) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from wild type(WT) and MCU knockout (KO) 293T(KO) cells, using MCU antibody (A22525) at1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 51-170 of human MCU (NP_612366.1). KO Validated Validated Isotype IgG