![[KO Validated] TRIM21/SS-A Rabbit mAb (A22724)](/upload/resize_cache/iblock/34c/340_340_140cd750bba9870f18aada2478b24840a/xmrxyu96idjj0ozhju1p6i1ku0g99xze.jpg "[KO Validated] TRIM21/SS-A Rabbit mAb (A22724)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] TRIM21/SS-A Rabbit mAb (A22724)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] TRIM21/SS-A Rabbit mAb Catalog No. A22724 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57363 Background
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 251-350 of human TRIM21/SS-A(NP_003132.2). Sequence LERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG Gene ID Swiss Prot Synonyms SSA; RO52; SSA1; RNF81; Ro/SSA Calculated MW 54kDa Observed MW 50kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:5000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-1080, 293T Cellular location Cytoplasm, Cytoplasmic vesicle, Nucleus, P-body, autophagosome 
Western blot analysis of HT-1080, using TRIM21/SS-A antibody (A22724) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from wild type(WT) and TRIM21/SS-A knockout (KO) 293T(KO) cells, using TRIM21/SS-A antibody (A22724) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 251-350 of human TRIM21/SS-A(NP_003132.2). KO Validated Validated Isotype IgG