![[KO Validated] BRD7 Rabbit pAb (A2308)](/upload/resize_cache/iblock/fdb/340_340_140cd750bba9870f18aada2478b24840a/hhpn9yfzlb2ws9dagwavk07c3up074sb.jpg "[KO Validated] BRD7 Rabbit pAb (A2308)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] BRD7 Rabbit pAb (A2308)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] BRD7 Rabbit pAb Catalog No. A2308 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein which is a member of the bromodomain-containing protein family. The product of this gene has been identified as a component of one form of the SWI/SNF chromatin remodeling complex, and as a protein which interacts with p53 and is required for p53-dependent oncogene-induced senescence which prevents tumor growth. Pseudogenes have been described on chromosomes 2, 3, 6, 13 and 14. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). Sequence MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD Gene ID Swiss Prot Synonyms BP75; NAG4; CELTIX1; SMARCI1 Calculated MW 74kDa Observed MW 100kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, HepG2, SW620, 293T Cellular location Nucleus 
Western blot analysis of extracts of various cell lines, using BRD7 antibody (A2308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from normal (control) and BRD7 Rabbit pAb knockout (KO) 293T cells, using BRD7 Rabbit pAb antibody (A2308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). KO Validated Validated Isotype IgG