![[KO Validated] HPRT1 Rabbit mAb (A8783)](/upload/resize_cache/iblock/717/340_340_140cd750bba9870f18aada2478b24840a/g2xymxlxtdnkm0ikctcealh6igu26dt3.jpg "[KO Validated] HPRT1 Rabbit mAb (A8783)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HPRT1 Rabbit mAb (A8783)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HPRT1 Rabbit mAb Catalog No. A8783 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1300 Background
The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (NP_000185.1). Sequence GDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Gene ID Swiss Prot Synonyms HPRT; HGPRT Calculated MW 25kDa Observed MW 25kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, NIH/3T3, Mouse brain, Mouse heart, Rat heart, Rat thymus Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using HPRT11 Rabbit mAb (A8783) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and HPRT1 knockout (KO) 293T cells, using HPRT1 antibody (A8783) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (NP_000185.1). KO Validated Validated Isotype IgG