![[KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)](/upload/resize_cache/iblock/765/340_340_140cd750bba9870f18aada2478b24840a/xupq1xwu5fjil2inqjp8npuc9ozng288.jpg "[KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] PEPCK/PCK2 Rabbit mAb (A4466)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] PEPCK/PCK2 Rabbit mAb Catalog No. A4466 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1017 Background
This gene encodes a mitochondrial enzyme that catalyzes the conversion of oxaloacetate to phosphoenolpyruvate in the presence of guanosine triphosphate (GTP). A cytosolic form of this protein is encoded by a different gene and is the key enzyme of gluconeogenesis in the liver. Alternatively spliced transcript variants have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822). Sequence ENARVLDWICRRLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAELEALERRVHKM Gene ID Swiss Prot Synonyms PEPCK; PEPCK2; PEPCK-M Calculated MW 71kDa Observed MW 71kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, 293T, Hep G2, Mouse lung, Mouse brain, Mouse spleen, Rat kidney Cellular location Mitochondrion 
Western blot analysis of extracts of various cell lines, using PEPCK/PEPCK/PCK2 Rabbit mAb (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type(WT) and PEPCK/PCK2 knockout (KO) 293T cells, using PEPCK/PCK2 antibody (A4466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HeLa cells using PEPCK/PEPCK/PCK2 Rabbit mAb (A4466) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 550-640 of human PEPCK/PEPCK/PCK2 (Q16822). KO Validated Validated Isotype IgG