[KO Validated] Cytochrome C Rabbit mAb (A4912)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Cytochrome C Rabbit mAb
Catalog No.	A4912
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1153

Background

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999).
Sequence	MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Gene ID
Swiss Prot
Synonyms	CYC; HCS; THC4
Calculated MW	12kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat kidney
Cellular location	Mitochondrion intermembrane space
Customer validation	WB(Homo sapiens, lamprey, Mus musculus, Rattus norvegicus, Plagiomnium acutum) IF(Homo sapiens, Plagiomnium acutum)

Western blot analysis of extracts of various cell lines, using Cytochrome C Rabbit mAb (A4912) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from wild type (WT) and Cytochrome C knockout (KO) 293T cells, using Cytochrome C antibody (A4912) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded rat kidney using Cytochrome C Rabbit mAb (A4912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human appendix using Cytochrome C Rabbit mAb (A4912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999).
KO Validated	Validated
Isotype	IgG