![[KO Validated] ATPIF1 Rabbit pAb (A5099)](/upload/resize_cache/iblock/20a/340_340_140cd750bba9870f18aada2478b24840a/8wkdxitriuya3y4sn0dmtkd0onydn989.jpg "[KO Validated] ATPIF1 Rabbit pAb (A5099)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ATPIF1 Rabbit pAb (A5099)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ATPIF1 Rabbit pAb Catalog No. A5099 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables several functions, including ATPase binding activity; angiostatin binding activity; and mitochondrial proton-transporting ATP synthase complex binding activity. Involved in several processes, including mitochondrial depolarization; negative regulation of ATPase activity; and regulation of protein targeting to mitochondrion. Located in cell surface and mitochondrion.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). Sequence GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD Gene ID Swiss Prot Synonyms IP; ATPI; ATPIP; ATPIF1 Calculated MW 12kDa Observed MW 12kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:100
- IP 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples 293T Cellular location Mitochondrion 
Western blot analysis of extracts from wild type(WT) and ATPIF1 knockout (KO) 293T(KO) cells, using ATPIF1 antibody (A5099) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of U2OS cells using ATPIF1 antibody (A5099) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 μg extracts of K-562 cells using 3 μg [KO Validated] ATPIF1 Rabbit pAb (A5099). Western blot was performed from the immunoprecipitate using [KO Validated] ATPIF1 Rabbit pAb (A5099) at a dilition of 1:3000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-106 of human ATPIF1 (NP_057395.1). KO Validated Validated Isotype IgG