![[KO Validated] DNMT3A Rabbit pAb (A6503)](/upload/resize_cache/iblock/c0b/340_340_140cd750bba9870f18aada2478b24840a/345lvy70ivr9em70b1adplws8e5i2cec.jpg "[KO Validated] DNMT3A Rabbit pAb (A6503)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] DNMT3A Rabbit pAb (A6503)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] DNMT3A Rabbit pAb Catalog No. A6503 Host species Rabbit Purification method Affinity purification Isotype IgG Background
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DNMT3A (NP_072046.2). Sequence DWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP Gene ID Swiss Prot Synonyms TBRS; HESJAS; DNMT3A2; M.HsaIIIA Calculated MW 102kDa Observed MW 140kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, MCF7, HT-29, BT-474, HepG2, SW620 Cellular location Cytoplasm, Nucleus 
Western blot analysis of various lysates, using DNMT3A antibody (A6503) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and DNMT3A knockout (KO) 293T(KO) cells, using DNMT3A antibody (A6503) at 1:600 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DNMT3A (NP_072046.2). KO Validated Validated Isotype IgG