![[KO Validated] VRK1 Rabbit pAb (A7745)](/upload/resize_cache/iblock/66c/340_340_140cd750bba9870f18aada2478b24840a/9udkq6z0vqas0xiv19xcfn7pmy5q8uuq.jpg "[KO Validated] VRK1 Rabbit pAb (A7745)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] VRK1 Rabbit pAb (A7745)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] VRK1 Rabbit pAb Catalog No. A7745 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human VRK1 (NP_003375.1). Sequence GHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK Gene ID Swiss Prot Synonyms PCH1; PCH1A Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:100 - 1:500
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T, MCF-7, Jurkat, A-549, HeLa Cellular location Cytoplasm, Nucleus, cytoskeleton, spindle Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using VRK1 antibody (A7745) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of extracts from wild type(WT) and VRK1 knockout (KO) 293T cells, using VRK1 antibody (A7745) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat lung using VRK1 antibody (A7745) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using VRK1 antibody (A7745) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 257-396 of human VRK1 (NP_003375.1). KO Validated Validated Isotype IgG