![[KO Validated] KDM5B Rabbit pAb (A7772)](/upload/resize_cache/iblock/f28/340_340_140cd750bba9870f18aada2478b24840a/zauw2m2vxdxh3n93pwpufgt89poeez4u.jpg "[KO Validated] KDM5B Rabbit pAb (A7772)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] KDM5B Rabbit pAb (A7772)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] KDM5B Rabbit pAb Catalog No. A7772 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B (NP_006609.3). Sequence EESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVNELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEE Gene ID Swiss Prot Synonyms CT31; PLU1; PUT1; MRT65; PLU-1; JARID1B; PPP1R98; RBP2-H1; RBBP2H1A Calculated MW 176kDa Observed MW 176kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Nucleus Customer validation WB(Human hepatocellular carcinoma cell line, Homo sapiens)
IP(Homo sapiens)
Western blot analysis of extracts from normal (control) and KDM5B knockout (KO) 293T cells, using KDM5B antibody (A7772) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of L929 using KDM5B antibody (A7772) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 784-883 of human KDM5B (NP_006609.3). KO Validated Validated Isotype IgG