![[KO Validated] RB Rabbit pAb (A0003)](/upload/resize_cache/iblock/a83/340_340_140cd750bba9870f18aada2478b24840a/39f1dt479i6nrkgi7rqigyzsf5um9mo1.jpg "[KO Validated] RB Rabbit pAb (A0003)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] RB Rabbit pAb (A0003)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] RB Rabbit pAb Catalog No. A0003 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2). Sequence RSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH Gene ID Swiss Prot Synonyms RB; pRb; OSRC; pp110; p105-Rb; PPP1R130; p110-RB1 Calculated MW 106kDa Observed MW 110kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, A-431 Cellular location Nucleus Customer validation WB(Homo sapiens, Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using RB antibody (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and RB Rabbit pAb knockout (KO) HeLa cells, using RB Rabbit pAb antibody (A0003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of Y79 cells using Rb Polyclonal Antibody (A0003) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human RB (NP_000312.2). KO Validated Validated Isotype IgG