![[KO Validated] Bax Rabbit pAb (A0207)](/upload/resize_cache/iblock/380/340_340_140cd750bba9870f18aada2478b24840a/p1itj6k2bya82wl3xw92i7cb590qf1cx.jpg "[KO Validated] Bax Rabbit pAb (A0207)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Bax Rabbit pAb (A0207)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Bax Rabbit pAb Catalog No. A0207 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1). Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF Gene ID Swiss Prot Synonyms BCL2L4 Calculated MW 21kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples HT-1080, Raji, 293T Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein Customer validation WB(Eoma cell, Human pancreatic cancer cells, Human skin T cell lymphoma, Hut102, HCT116, Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus, Giardia duodenalis, Capra hircus, Ctenopharyngodon, Ctenopharyngodon idellus, lamprey, quails, crab, Mus musculus、Sus scrofa, Coturnix japonica, Bos taurus)
IF(Human liver cell, Rattus norvegicus)
IF(Homo sapiens)
IHC(Mus musculus, Rattus norvegicus, Homo sapiens)
IHC(Gallus gallus)
IP(Mus musculus)
RT-PCR(Homo sapiens)
WB(Mus musculus,Homo sapiens)
FC(Bos taurus)
Western blot analysis of extracts from normal (control) and Bax knockout (KO) 293T cells, using Bax antibody (A0207) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using Bax antibody (A0207) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Mouse brain , using Bax antibody (A0207) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of MCF7 cells using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1). KO Validated Validated Isotype IgG