- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDKN2A/p16INK4a Rabbit pAb Catalog No. A0262 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-156 of human CDKN2A/p16INK4a (NP_000068.1). Sequence QVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Gene ID Swiss Prot Synonyms ARF; MLM; P14; P16; P19; CMM2; INK4; MTS1; TP16; CDK4I; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A Calculated MW 8kDa/11kDa/12kDa/13kDa/16kDa/17kDa Observed MW 16kDa Applications
Reactivity Human Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, HeLa Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens, Mus musculus, Rattus norvegicus)
IF(Mus musculus)
ICC(Homo sapiens,Mus musculus)
IF(Mus musculus, Rattus norvegicus, Homo sapiens)
IHC(Mus musculus, Homo sapiens)
IHC(Homo sapiens, Mus musculus, Rattus norvegicus)
IHC,IF,WB(Rattus norvegicus)
WB IF(Mus musculus)

Western blot analysis of HeLa, using CDKN2A/p16INK4a antibody (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and CDKN2A/p16INK4a knockout (KO) 293T(KO) cells, using CDKN2A/p16INK4a antibody (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HeLa cells using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-156 of human CDKN2A/p16INK4a (NP_000068.1). KO Validated Validated Isotype IgG







