![[KO Validated] CD133 Rabbit mAb (A0818)](/upload/resize_cache/iblock/e18/340_340_140cd750bba9870f18aada2478b24840a/edhdrcy1baogx9kz12s0bc1s006n43mo.jpg "[KO Validated] CD133 Rabbit mAb (A0818)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CD133 Rabbit mAb (A0818)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CD133 Rabbit mAb Catalog No. A0818 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2543 Background
This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490). Sequence IPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQGYQSLNDIPDRVQRQTTTVVA Gene ID Swiss Prot Synonyms RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061 Calculated MW 97kDa Observed MW 120kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HT-29, HCT116 Cellular location Apical cell membrane, Cell projection, Endoplasmic reticulum, Endoplasmic reticulum-Golgi intermediate compartment, Multi-pass membrane protein, cilium, microvillus membrane, photoreceptor outer segment Customer validation IF(Homo sapiens)
Western blot analysis of extracts of HT-29 cells, using CD133 antibody (A0818) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from wild type (WT) and CD133 knockout (KO) HCT116 cells, using CD133 antibody (A0818) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CD133 Rabbit mAb (A0818) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-380 of human CD133 (O43490). KO Validated Validated Isotype IgG