![[KO Validated] LDHA Rabbit mAb (A0861)](/upload/resize_cache/iblock/e57/340_340_140cd750bba9870f18aada2478b24840a/rnhj4bm44lb52x67zpvcxpxs0xzw4nue.jpg "[KO Validated] LDHA Rabbit mAb (A0861)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] LDHA Rabbit mAb (A0861)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] LDHA Rabbit mAb Catalog No. A0861 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2669 Background
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338). Sequence VWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI Gene ID Swiss Prot Synonyms LDHM; GSD11; PIG19; HEL-S-133P Calculated MW 37kDa Observed MW 37kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, MCF7 Cellular location Cytoplasm Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus )
IHC(Homo sapiens,Rattus norvegicus )
Western blot analysis of MCF7, using LDHA antibody (A0861) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from wild type(WT) and LDHA knockout (KO) 293T cells, using [KO Validated] LDHA Rabbit mAb (A0861) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] LDHA Rabbit mAb (A0861) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] LDHA Rabbit mAb (A0861) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using [KO Validated] LDHA Rabbit mAb (A0861) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338). KO Validated Validated Isotype IgG