быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ErbB3/HER3 Rabbit pAb (A0950)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ErbB3/HER3 Rabbit pAb Catalog No. A0950 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2). Sequence DYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQRT Gene ID Swiss Prot Synonyms HER3; FERLK; LCCS2; VSCN1; ErbB-3; c-erbB3; erbB3-S; MDA-BF-1; c-erbB-3; p180-ErbB3; p45-sErbB3; p85-sErbB3 Calculated MW 148kDa Observed MW 185kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, MCF7, A-431, Mouse liver Cellular location Cell membrane, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ErbB3/HER3 antibody (A0950) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts from normal (control) and ErbB3/HER3 knockout (KO) 293T cells, using ErbB3/HER3 antibody (A0950) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1275-1342 of human ErbB3/HER3 (NP_001973.2). KO Validated Validated Isotype IgG







