![[KO Validated] Caspase-3 Rabbit pAb (A11040)](/upload/resize_cache/iblock/b23/340_340_140cd750bba9870f18aada2478b24840a/0t4hzklje1uxe3jdl94rsi6puq52jo16.jpg "[KO Validated] Caspase-3 Rabbit pAb (A11040)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Caspase-3 Rabbit pAb (A11040)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Caspase-3 Rabbit pAb Catalog No. A11040 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2). Sequence SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD Gene ID Swiss Prot Synonyms CPP32; SCA-1; CPP32B Calculated MW 32kDa Observed MW 32kDa/17kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T, Jurkat Cellular location Cytoplasm Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts of Jurkat cells, using Caspase-3 antibody (A11040) at 1:1000 dilution.Jurkat cells were treated by staurosporine(1 uM) for 3 hour.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and Caspase-3 knockout (KO) 293T cells, using Caspase-3 antibody (A11040) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Caspase-3 Rabbit pAb (A11040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] Caspase-3 Rabbit pAb (A11040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using [KO Validated] Caspase-3 Rabbit pAb (A11040) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2). KO Validated Validated Isotype IgG