![[KO Validated] EGFR Rabbit pAb (A11082)](/upload/resize_cache/iblock/74e/340_340_140cd750bba9870f18aada2478b24840a/wf3f13zq4z020s7uhkhaj2tuz5e75me9.jpg "[KO Validated] EGFR Rabbit pAb (A11082)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] EGFR Rabbit pAb (A11082)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] EGFR Rabbit pAb Catalog No. A11082 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1026-1126 of human EGFR (NP_005219.2). Sequence SSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQ Gene ID Swiss Prot Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2 Calculated MW 134kDa Observed MW 175kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Immunofluorescence Positive samples HeLa, Mouse liver, Rat liver Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts from normal (control) and EGFR knockout (KO) HeLa cells, using EGFR antibody (A11082) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Mouse liver, using EGFR antibody (A11082) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts of Rat liver, using EGFR antibody (A11082) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Immunofluorescence analysis of A-431 cells using [KO Validated] EGFR Rabbit pAb (A11082) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Mouse liver using 3 μg EGFR antibody (A11082). Western blot was performed from the immunoprecipitate using EGFR antibody (A11082) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1026-1126 of human EGFR (NP_005219.2). KO Validated Validated Isotype IgG