![[KO Validated] CDK4 Rabbit mAb (A11136)](/upload/resize_cache/iblock/d10/340_340_140cd750bba9870f18aada2478b24840a/nbu5w9dn3jpwmg1i65f30dcve8qd6vks.jpg "[KO Validated] CDK4 Rabbit mAb (A11136)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDK4 Rabbit mAb (A11136)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDK4 Rabbit mAb Catalog No. A11136 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC51004 Background
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). Sequence FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Gene ID Swiss Prot Synonyms CMM3; PSK-J3 Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat, Monkey Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, COS-7, Mouse lung, Rat lung Cellular location Cytoplasm, Membrane, Nucleus Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of various lysates, using CDK4 Rabbit mAb (A11136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type(WT) and CDK4 Rabbit mAb knockout (KO) HeLa(KO) cells, using CDK4 Rabbit mAb (A11136) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse lung using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse spleen using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat ovary using CDK4 Rabbit mAb (A11136) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Обезьяна Immunogen A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). KO Validated Validated Isotype IgG