![[KO Validated] FGF2 Rabbit mAb (A11488)](/upload/resize_cache/iblock/853/340_340_140cd750bba9870f18aada2478b24840a/j9m4vj5iv43cnyrdp45kxnsmi92gl8qu.jpg "[KO Validated] FGF2 Rabbit mAb (A11488)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] FGF2 Rabbit mAb (A11488)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] FGF2 Rabbit mAb Catalog No. A11488 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0618 Background
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). Sequence RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE Gene ID Swiss Prot Synonyms BFGF; FGFB; FGF-2; HBGF-2 Calculated MW 31kDa Observed MW 18kDa/22kDa/31kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:100 - 1:500
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, SKOV3 Cellular location Nucleus, Secreted Customer validation WB(Mus musculus, Homo sapiens)
ELISA(Homo sapiens)
Western blot analysis of extracts from wild type (WT) and FGF2 knockout (KO) HeLa cells, using FGF2 Rabbit mAb (A11488) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of SKOV3 cells, using FGF2 Rabbit mAb (A11488) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using [KO Validated] FGF2 Rabbit mAb (A11488) at dilution of 1:400 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using FGF2 Rabbit mAb (A11488) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5). KO Validated Validated Isotype IgG