![[KO Validated] RhoGDI Rabbit mAb (A11556)](/upload/resize_cache/iblock/3d6/340_340_140cd750bba9870f18aada2478b24840a/d8yo3qzzt4nzhrqipvc1yitbba3k26ll.jpg "[KO Validated] RhoGDI Rabbit mAb (A11556)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] RhoGDI Rabbit mAb (A11556)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] RhoGDI Rabbit mAb Catalog No. A11556 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0629 Background
This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). Sequence VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG Gene ID Swiss Prot Synonyms GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e Calculated MW 23kDa Observed MW 26kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, NIH/3T3, U-251MG, Mouse brain, Rat liver Cellular location Cytoplasm 
Western blot analysis of extracts of various cell lines, using RhoGDI Rabbit mAb (A11556) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from wild type (WT) and RhoGDI knockout (KO) 293T cells, using RhoGDI antibody (A11556) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). KO Validated Validated Isotype IgG