[KO Validated] Caspase-3 Rabbit pAb (A11953)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] Caspase-3 Rabbit pAb
Catalog No.	A11953
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
Sequence	SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Gene ID
Swiss Prot
Synonyms	CPP32; SCA-1; CPP32B
Calculated MW	32kDa
Observed MW	17kDa/35kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:200 IP 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, Jurkat, Raji, HepG2, Mouse spleen, Mouse liver, Rat heart, Rat brain
Cellular location	Cytoplasm
Customer validation	WB(Mouse embryonal fibroblast cell, Human gastric cancer cells, rat cells, HL60,Hut102, Rattus norvegicus, Gallus gallus, Homo sapiens, Mus musculus, Bos taurus, ) IHC(Mouse embryonal fibroblast cell, Rattus norvegicus, Mus musculus)

Western blot analysis of extracts of various cell lines, using Caspase-3 Rabbit pAb (A11953) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of extracts from normal (control) and Caspase-3 knockout (KO) 293T cells, using Caspase-3 antibody (A11953) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Immunohistochemistry analysis of paraffin-embedded human mammary cancer using Caspase-3 antibody (A11953) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Caspase-3 Rabbit pAb (A11953) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using [KO Validated] Caspase-3 Rabbit pAb (A11953) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using [KO Validated] Caspase-3 Rabbit pAb (A11953) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2).
KO Validated	Validated
Isotype	IgG