быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MTCH2 Rabbit pAb (A12934)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MTCH2 Rabbit pAb Catalog No. A12934 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1). Sequence VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGI Gene ID Swiss Prot Synonyms MIMP; HSPC032; SLC25A50 Calculated MW 33kDa Observed MW 33kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa Cellular location Mitochondrion inner membrane, Multi-pass membrane protein Customer validation WB(Mus musculus)

Western blot analysis of extracts from wild type(WT) and MTCH2 knockout (KO) HeLa(KO) cells, using MTCH2 antibody (A12934) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunofluorescence analysis of NIH-3T3 cells using MTCH2 Polyclonal Antibody (A12934) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using MTCH2 Polyclonal Antibody (A12934) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-175 of human MTCH2 (NP_055157.1). KO Validated Validated Isotype IgG







