![[KO Validated] NDUFB4 Rabbit pAb (A13820)](/upload/resize_cache/iblock/105/340_340_140cd750bba9870f18aada2478b24840a/phzf8aom3wgjjqf85l6zxsdbhtjdstvl.jpg "[KO Validated] NDUFB4 Rabbit pAb (A13820)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NDUFB4 Rabbit pAb (A13820)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NDUFB4 Rabbit pAb Catalog No. A13820 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electrons from NADH to ubiquinone.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). Sequence MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG Gene ID Swiss Prot Synonyms B15; CI-B15 Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples U-87MG, HeLa, 293T, Mouse heart, Mouse kidney, Mouse liver Cellular location Matrix side, Mitochondrion inner membrane, Single-pass membrane protein Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using NDUFB4 antibody (A13820) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and NDUFB4 knockout (KO) HeLa cells, using NDUFB4 antibody (A13820) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded human liver using [KO Validated] NDUFB4 Rabbit pAb (A13820) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] NDUFB4 Rabbit pAb (A13820) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat kidney using [KO Validated] NDUFB4 Rabbit pAb (A13820) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of L929 cells using NDUFB4 Polyclonal Antibody (A13820) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using NDUFB4 Polyclonal Antibody (A13820) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human NDUFB4 (NP_001161803.1). KO Validated Validated Isotype IgG