![[KO Validated] NDUFC2 Rabbit pAb (A15073)](/upload/resize_cache/iblock/9db/340_340_140cd750bba9870f18aada2478b24840a/knqhymenmhki1cr8ta8mfg91cp8oohda.jpg "[KO Validated] NDUFC2 Rabbit pAb (A15073)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NDUFC2 Rabbit pAb (A15073)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NDUFC2 Rabbit pAb Catalog No. A15073 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1). Sequence MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF Gene ID Swiss Prot Synonyms HLC-1; B14.5b; MC1DN36; NADHDH2; CI-B14.5b Calculated MW 14kDa Observed MW 14kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, OVCAR3, HeLa, A-549, mouse stomach, mouse brain, mouse heart, rat kidney Cellular location Matrix side, Mitochondrion inner membrane, Single-pass membrane protein Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using NDUFC2 antibody (A15073) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts from normal (control) and NDUFC2 knockout (KO) HeLa cells, using NDUFC2 antibody (A15073) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NDUFC2 (NP_004540.1). KO Validated Validated Isotype IgG