![[KO Validated] ITCH Rabbit mAb (A8624)](/upload/resize_cache/iblock/3cb/340_340_140cd750bba9870f18aada2478b24840a/wzl8vhcxsuxenz07ugkedn4fhehpgh28.jpg "[KO Validated] ITCH Rabbit mAb (A8624)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KO Validated] ITCH Rabbit mAb (A8624)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ITCH Rabbit mAb Catalog No. A8624 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1759 Background
This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ITCH (Q96J02). Sequence MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAAL Gene ID Swiss Prot Synonyms AIF4; AIP4; ADMFD; NAPP1 Calculated MW 103kDa Observed MW 103kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Raji, NIH/3T3, C6, Mouse lung Cellular location cell cortex, cytoplasm, cytoplasmic vesicle, cytosol, extracellular exosome, nucleoplasm, plasma membrane Customer validation Co-IP(Homo sapiens)
Western blot analysis of extracts of various cell lines, using ITCH Rabbit mAb (A8624) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using ITCH Rabbit mAb (A8624) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type (WT) and ITCH knockout (KO) 293T cells, using ITCH antibody (A8624) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ITCH (Q96J02). KO Validated Validated Isotype IgG