+7-495-308-45-67 Заказать звонок

[KO Validated] AIF Rabbit pAb (A2568)

быстрая доставка ~4 недели

Размер

100 μL
20 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] AIF Rabbit pAb
Catalog No.	A2568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and cognitive disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of human AIF (NP_004199.1).
Sequence	FPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Gene ID
Swiss Prot
Synonyms	AIF; AUNX1; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6; SEMDHL
Calculated MW	67kDa
Observed MW	67kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, SW620, 22Rv1, H460, PC-3, U-937, Mouse liver, Mouse kidney, Mouse heart
Cellular location	Cytoplasm, Mitochondrion inner membrane, Mitochondrion intermembrane space, Nucleus, perinuclear region
Customer validation	WB(Eoma cell, 293T, Homo sapiens, Mus musculus) IP(293T)

Western blot analysis of extracts of various cell lines, using AIF antibody (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Western blot analysis of extracts from normal (control) and AIF knockout (KO) 293T cells, using AIF antibody (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunofluorescence analysis of C6 cells using AIF antibody (A2568) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using AIF antibody (A2568) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of mouse skeletal muscle using AIF antibody (A2568) at dilution of 1:100. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of HeLa cells using AIFM1 antibody (A2568) at dilution of 1:200. Blue: DAPI for nuclear staining.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of human AIF (NP_004199.1).
KO Validated	Validated
Isotype	IgG