[KO Validated] PDCD4 Rabbit pAb (A2570)

быстрая доставка ~4 недели

Размер

100 μL
20 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] PDCD4 Rabbit pAb
Catalog No.	A2570
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PDCD4 (NP_055271.2).
Sequence	MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGGKGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQL
Gene ID
Swiss Prot
Synonyms	H731
Calculated MW	52kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, HeLa, MCF7, Mouse thymus
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Rattus norvegicus, Sus scrofa, mice)

Western blot analysis of extracts of various cell lines, using PDCD4 antibody (A2570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Western blot analysis of extracts from normal (control) and PDCD4 knockout (KO) 293T cells, using PDCD4 antibody (A2570) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using [KO Validated] PDCD4 Rabbit pAb (A2570) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human placenta using [KO Validated] PDCD4 Rabbit pAb (A2570) at dilution of 1:20 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PDCD4 (NP_055271.2).
KO Validated	Validated
Isotype	IgG