быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACHA4 Rabbit mAb (A0350)
- Описание
- Характеристики
-
Overview
Product name ACHA4 Rabbit mAb Catalog No. A0350 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1822 Background
This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681). Sequence PEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSVSPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR Gene ID Swiss Prot Synonyms EBN; BFNC; EBN1; NACHR; NACRA4; NACHRA4 Calculated MW 70kDa Observed MW 70kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, U-251MG, C6, Mouse liver, Mouse brain, Rat testis Cellular location Cell junction, Cell membrane, Lipid-anchor, Multi-pass membrane protein, postsynaptic cell membrane, synapse 
Western blot analysis of extracts of various cell lines, using ACHA4 Rabbit mAb (A0350) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ACHA4 (P43681). Isotype IgG







