быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
UPP1 Rabbit mAb (A0613)
- Описание
- Характеристики
-
Overview
Product name UPP1 Rabbit mAb Catalog No. A0613 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2531 Background
This gene encodes a uridine phosphorylase, an enzyme that catalyzes the reversible phosphorylation of uridine (or 2'- deoxyuridine) to uracil and ribose-1-phosphate (or deoxyribose-1-phosphate). The encoded enzyme functions in the degradation and salvage of pyrimidine ribonucleosides.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831). Sequence MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKV Gene ID Swiss Prot Synonyms UP; UPP; UPASE; UDRPASE Calculated MW 34kDa Observed MW 34kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, Rat large intestine, Rat lung, Rat heart, Mouse large intestine, Mouse lung, Mouse kidney Cellular location Cytosol, Nucleoplasm 
Western blot analysis of extracts of various cell lines, using UPP1 antibody (A0613) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPP1 (Q16831). Isotype IgG