быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
USP24 Rabbit mAb (A0621)
- Описание
- Характеристики
-
Overview
Product name USP24 Rabbit mAb Catalog No. A0621 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2526 Background
Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP24 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 2500-2600 of human USP24 (Q9UPU5). Sequence VKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGDRHLQQ Gene ID Swiss Prot Synonyms USP24; ubiquitin specific peptidase 24 Calculated MW 294kDa Observed MW 295kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples SH-SY5Y, Mouse liver, Rat liver Cellular location cytosol, nucleoplasm, nucleus 
Western blot analysis of various lysates, using USP24 antibody (A0621) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 2500-2600 of human USP24 (Q9UPU5). Isotype IgG