быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Tyro3 Rabbit mAb (A0730)
- Описание
- Характеристики
-
Overview
Product name Tyro3 Rabbit mAb Catalog No. A0730 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1841 Background
The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 791-890 of human Tyro3 (Q06418). Sequence GQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC Gene ID Swiss Prot Synonyms BYK; Dtk; RSE; Rek; Sky; Tif; Etk-2 Calculated MW 97kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6, SH-SY5Y, Mouse testis, Mouse brain Cellular location Cell membrane 
Western blot analysis of extracts of various cell lines, using Tyro3 Rabbit mAb (A0730) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 791-890 of human Tyro3 (Q06418). Isotype IgG