быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
VPS24 Rabbit mAb (A0941)
- Описание
- Характеристики
-
Overview
Product name VPS24 Rabbit mAb Catalog No. A0941 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1849 Background
This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7). Sequence KEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATL Gene ID Swiss Prot Synonyms NEDF; VPS24; CGI-149 Calculated MW 25kDa Observed MW 29kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, A549, SH-SY5Y, Mouse brain, Rat brain Cellular location Cytoplasm, Endosome, Late endosome membrane, Lipid-anchor, Membrane, cytosol 
Western blot analysis of extracts of various cell lines, using VPS24 Rabbit mAb (A0941) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 65-220 of human VPS24 (Q9Y3E7). Isotype IgG