быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ACE1 Rabbit mAb (A11357)
- Описание
- Характеристики
-
Overview
Product name ACE1 Rabbit mAb Catalog No. A11357 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0577 Background
This gene encodes an enzyme involved in blood pressure regulation and electrolyte balance. It catalyzes the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This angiotensin converting enzyme (ACE) also inactivates the vasodilator protein, bradykinin. Accordingly, the encoded enzyme increases blood pressure and is a drug target of ACE inhibitors, which are often prescribed to reduce blood pressure. This enzyme additionally plays a role in fertility through its ability to cleave and release GPI-anchored membrane proteins in spermatozoa. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme. This polymorphism, as well as mutations in this gene, have been implicated in a wide variety of diseases including cardiovascular pathophysiologies, psoriasis, renal disease, stroke, and Alzheimer's disease. Regulation of the homologous ACE2 gene may be involved in progression of disease caused by several human coronaviruses, including SARS-CoV and SARS-CoV-2. Alternative splicing results in multiple transcript variants encoding both somatic (sACE) and male-specific testicular (tACE) isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1306 of human ACE1 (P12821). Sequence YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS Gene ID Swiss Prot Synonyms DCP; ACE1; DCP1; CD143 Calculated MW 150kDa Observed MW 170kDa Applications
Reactivity Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples Mouse lung, Mouse kidney, Rat kidney Cellular location Cell membrane, Cytoplasm, Secreted, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using ACE1 Rabbit mAb (A11357) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunoprecipitation analysis of 600 μg extracts of Mouse kidney cells using 3 μg ACE1 antibody (A11357). Western blot was performed from the immunoprecipitate using ACE1 antibody (A11357) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1200-1306 of human ACE1 (P12821). Isotype IgG







