быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
δ-Catenin/p120 Catenin Rabbit mAb (A11399)
- Описание
- Характеристики
-
Overview
Product name δ-Catenin/p120 Catenin Rabbit mAb Catalog No. A11399 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0586 Background
This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 869-968 of human δ-Catenin/p120 Catenin (O60716). Sequence TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI Gene ID Swiss Prot Synonyms CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN) Calculated MW 108kDa Observed MW 100kDa/110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunoprecipitation Positive samples HeLa cells, U-87MG cells, Mouse testis, Rat brain Cellular location Cell membrane, Cytoplasm Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry of paraffin-embedded human breast using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human placenta using δ-Catenin/p120 Catenin Rabbit mAb (A11399) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 600 μg extracts of Mouse testis cells using 3 μg δ-Catenin/p120 Catenin antibody (A11399). Western blot was performed from the immunoprecipitate using δ-Catenin/p120 Catenin antibody (A11399) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 869-968 of human δ-Catenin/p120 Catenin (O60716). KO Validated Validated Isotype IgG