быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
von Willebrand factor (VWF) Rabbit mAb (A13523)
- Описание
- Характеристики
-
Overview
Product name von Willebrand factor (VWF) Rabbit mAb Catalog No. A13523 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0716 Background
This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human von Willebrand factor (VWF) (P04275). Sequence APACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCEVAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGGLVVPPTDAPVSPTTLYVEDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFV Gene ID Swiss Prot Synonyms VWD; F8VWF Calculated MW 309kDa Observed MW 309kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse liver Cellular location Secreted, extracellular matrix, extracellular space Customer validation WB(Homo sapiens)
Western blot analysis of extracts of Mouse liver, using von Willebrand factor (VWF) Rabbit mAb (A13523) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunohistochemistry analysis of paraffin-embedded human esophageal using von Willebrand factor (VWF) Rabbit mAb (A13523) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human von Willebrand factor (VWF) (P04275). Isotype IgG