быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
USP39 Rabbit mAb (A1393)
- Описание
- Характеристики
-
Overview
Product name USP39 Rabbit mAb Catalog No. A1393 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2565 Background
Predicted to enable thiol-dependent deubiquitinase and zinc ion binding activity. Involved in spliceosomal complex assembly. Located in nucleoplasm. Part of U4/U6 x U5 tri-snRNP complex.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human USP39 (Q53GS9). Sequence QQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVLQALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML Gene ID Swiss Prot Synonyms 65K; SAD1; CGI-21; HSPC332; SNRNP65 Calculated MW 65kDa Observed MW 65kDa Applications
Reactivity Human, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HCT116 Cellular location Nucleus 
Western blot analysis of extracts from HCT116 cells, using USP39 antibody (A1393) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using USP39 Rabbit mAb (A1393) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat testis using USP39 Rabbit mAb (A1393) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human USP39 (Q53GS9). Isotype IgG