быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZNF259 Rabbit mAb (A1487)
- Описание
- Характеристики
-
Overview
Product name ZNF259 Rabbit mAb Catalog No. A1487 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2563 Background
The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312). Sequence DIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR Gene ID Swiss Prot Synonyms GKAF; ZNF259 Calculated MW 51kDa Observed MW 51kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Mouse brain Cellular location Cajal body, Cell projection, Cytoplasm, Nucleus, axon, gem, growth cone, nucleolus, perinuclear region 
Western blot analysis of extracts from Mouse brain, using ZNF259 antibody (A1487) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using ZNF259 Rabbit mAb (A1487) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 360-459 of human ZNF259 (O75312). Isotype IgG