быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TRK fused gene (TFG) Rabbit mAb (A1534)
- Описание
- Характеристики
-
Overview
Product name TRK fused gene (TFG) Rabbit mAb Catalog No. A1534 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1882 Background
There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human TRK fused gene (TFG) (Q92734). Sequence APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR Gene ID Swiss Prot Synonyms TF6; HMSNP; SPG57; TRKT3 Calculated MW 43kDa Observed MW 55kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, Mouse testis, Mouse brain Cellular location cytoplasm, cytosol, endoplasmic reticulum exit site 
Western blot analysis of extracts of Jurkat cells, using TRK fused gene (TFG) (TFG) Rabbit mAb (A1534) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using TRK fused gene (TFG) (TFG) Rabbit mAb (A1534) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 301-400 of human TRK fused gene (TFG) (Q92734). Isotype IgG