быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
VPS18 Rabbit mAb (A17563)
- Описание
- Характеристики
-
Overview
Product name VPS18 Rabbit mAb Catalog No. A17563 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2156 Background
Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene encodes the human homolog of yeast class C Vps18 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS18 (Q9P253). Sequence MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKV Gene ID Swiss Prot Synonyms PEP3 Calculated MW 110kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, Mouse lung, Mouse brain, Rat brain Cellular location Autophagosome, Clathrin-coated vesicle, CORVET complex, Early endosome, endosome, Glutamatergic synapse, Late endosome, Lysosome, Presynapse 
Western blot analysis of extracts of various cell lines, using VPS18 Rabbit mAb (A17563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of extracts of Rat brain, using VPS18 Rabbit mAb (A17563) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VPS18 (Q9P253). Isotype IgG