быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910)
- Описание
- Характеристики
-
Overview
Product name α-Smooth Muscle Actin (ACTA2) Rabbit mAb Catalog No. A17910 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0298 Background
This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (P62736). Sequence MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAP Gene ID Swiss Prot Synonyms ACTSA Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples RD, Mouse large intestine, Mouse brain, Rat lung Cellular location Cytoplasm, cytoskeleton Customer validation (Hela 293T KYM-1 U87-MG SKOV-3 U2-OS )
IHC(Mus musculus, Rattus norvegicus, Homo sapiens)
WB(Fruit Fly, Zea mays, Mus musculus, Rattus norvegicus, Oryza sativa, Homo sapiens, N. benthamiana, Arabidopsis thaliana, mouse, Nicotiana tabacum, Triticum aestivum)
IHC(Rattus norvegicus, Mus musculus)
IF(Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus)
IF(Mus musculus, Homo sapiens, Rattus norvegicus)
IHC、WB(Rattus norvegicus)
IHC(Homo sapiens,Rattus norvegicus)
WB(Homo sapiens)
IB IF(Mus musculus)
IHC，IF(Mus musculus)
qPCR(Arabidopsis thaliana)
Western blot analysis of various lysates, using α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded mouse liver using α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of smooth muscle of human colon carcinoma using α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse colon using α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat colon using α-Smooth Muscle Actin (ACTA2) Rabbit mAb (A17910) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human α-Smooth Muscle Actin (ACTA2) (P62736). Isotype IgG