быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
βIII-Tubulin Rabbit mAb (A17913)
- Описание
- Характеристики
-
Overview
Product name βIII-Tubulin Rabbit mAb Catalog No. A17913 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0456 Background
This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin (Q13509). Sequence VAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDEEESEAQGPK Gene ID Swiss Prot Synonyms CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A Calculated MW 50kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain Cellular location Cytoplasm, cytoskeleton Customer validation WB(Rattus norvegicus, Mus musculus, Homo sapiens)
IF(Homo sapiens, Rattus norvegicus, African green monkey )
Western blot analysis of extracts of various cell lines, using βIII-Tubulin/β3-Tubulin antibody (A17913) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.
Immunofluorescence analysis of SH-SY5Y cells using βIII-Tubulin/β3-Tubulin Rabbit mAb (A17913) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse brain using βIII-Tubulin/β3-Tubulin Rabbit mAb (A17913) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of rat brain using βIII-Tubulin/β3-Tubulin Rabbit mAb (A17913) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 351-450 of human βIII-Tubulin (Q13509). Isotype IgG