быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
VEGFR1 Rabbit mAb (A19132)
- Описание
- Характеристики
-
Overview
Product name VEGFR1 Rabbit mAb Catalog No. A19132 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0363 Background
This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948). Sequence MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN Gene ID Swiss Prot Synonyms FLT; FLT-1; VEGFR1; VEGFR-1; FRT Calculated MW 151kDa Observed MW 180kDa Applications
Reactivity Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat heart, Rat brain, Mouse lung, Mouse brain Cellular location Cell membrane, Cytoplasm, Endosome, Secreted, Single-pass type I membrane protein Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using VEGFR1 antibody (A19132) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using VEGFR1 antibody (A19132) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VEGFR1 (P17948). Isotype IgG