быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TROY/TNFRSF19 Rabbit mAb (A19235)
- Описание
- Характеристики
-
Overview
Product name TROY/TNFRSF19 Rabbit mAb Catalog No. A19235 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2393 Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68). Sequence RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK Gene ID Swiss Prot Synonyms TAJ; TROY; TRADE; TAJ-alpha Calculated MW 46kDa Observed MW 46kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 22Rv1, Raji, U-251MG, Mouse lung, Mouse brain, Mouse spleen, Rat lung, Rat brain Cellular location Membrane, Single-pass type I membrane protein 
Western blot analysis of extracts of various cell lines, using TROY/TNFRSF19 antibody (A19235) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68). Isotype IgG