быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
VEGF-D Rabbit mAb (A19242)
- Описание
- Характеристики
-
Overview
Product name VEGF-D Rabbit mAb Catalog No. A19242 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2402 Background
The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGF-D (O43915). Sequence YSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC Gene ID Swiss Prot Synonyms FIGF; VEGF-D Calculated MW 40kDa Observed MW 41kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HT-29, A549, NCI-H460, H9C2, Mouse lung, Mouse heart, Rat heart Cellular location Secreted 
Western blot analysis of extracts of various cell lines, using VEGF-D antibody (A19242) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGF-D (O43915). Isotype IgG