быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TSC2 Rabbit mAb (A19540)
- Описание
- Характеристики
-
Overview
Product name TSC2 Rabbit mAb Catalog No. A19540 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0019 Background
This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815). Sequence AKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHPPSHSKAPAQTPAEPTPGYEVGQRKRLISSVEDFTEFV Gene ID Swiss Prot Synonyms LAM; TSC4; PPP1R160 Calculated MW 201kDa Observed MW 200kDa Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples PC-3, 293T Cellular location Cytoplasm, Membrane, Peripheral membrane protein 
Western blot analysis of extracts of various cell lines, using TSC2 antibody (A19540) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg TSC2 antibody (A19540). Western blot was performed from the immunoprecipitate using TSC2 antibody (A19540) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1700-1807 of human Tuberin (P49815). Isotype IgG