быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
5T4 Rabbit mAb (A19541)
- Описание
- Характеристики
-
Overview
Product name 5T4 Rabbit mAb Catalog No. A19541 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2167 Background
This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is associated with poor clinical outcome in numerous cancers. Alternate splicing in the 5' UTR results in multiple transcript variants that encode the same protein.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 321-420 of human 5T4 (Q13641). Sequence LTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV Gene ID Swiss Prot Synonyms 5T4; M6P1; 5T4AG; WAIF1 Calculated MW 46kDa Observed MW 75kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples A549, MCF7 Cellular location Plasma membrane 
Western blot analysis of extracts of various cell lines, using 5T4 Rabbit mAb (A19541) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 321-420 of human 5T4 (Q13641). Isotype IgG