быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
WNT2B Rabbit mAb (A19554)
- Описание
- Характеристики
-
Overview
Product name WNT2B Rabbit mAb Catalog No. A19554 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2172 Background
This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as carcinogenesis. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human WNT2B (Q93097). Sequence KAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV Gene ID Swiss Prot Synonyms WNT13 Calculated MW 44kDa Observed MW 50kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, PC-3, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat testis, Rat uterus Cellular location extracellular region, extracellular space 
Western blot analysis of extracts of various cell lines, using WNT2B Rabbit mAb (A19554) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human WNT2B (Q93097). Isotype IgG