быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ZIC1 Rabbit mAb (A19558)
- Описание
- Характеристики
-
Overview
Product name ZIC1 Rabbit mAb Catalog No. A19558 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2173 Background
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZIC1 (Q15915). Sequence MLLDAGPQYPAIGVTTFGASRHHSAGDVAERDVGLGINPFADGMGAFKLNPSSHELASAGQTAFTSQAPGYAAAAALGHHHHPGHVGSYSSAAFNSTRDF Gene ID Swiss Prot Synonyms ZIC; CRS6; BAIDCS; ZNF201 Calculated MW 48kDa Observed MW 48kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples C6, SH-SY5Y Cellular location cytoplasm, nucleoplasm, nucleus 
Western blot analysis of extracts of various cell lines, using ZIC1 Rabbit mAb (A19558) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZIC1 (Q15915). Isotype IgG